CD158d/KIR2DL4, Human (HEK293, His)
CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential[1][2].
Product Specifications
Product Name Alternative
CD158d/KIR2DL4 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd158d-kir2dl4-protein-human-hek293-his.html
Purity
97.05
Smiles
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
Molecular Formula
3805 (Gene_ID) ADY38409.1 (W22-H242) (Accession)
Molecular Weight
Approximately 30-40 kDa due to the glycosylation
References & Citations
[1]Faure M, et, al. KIR2DL4 (CD158d), an NK cell-activating receptor with inhibitory potential. J Immunol. 2002 Jun 15;168 (12) :6208-14.|[2]Lanier LL. NK cell recognition. Annu Rev Immunol. 2005;23:225-74.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942956-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550856-100 1x 100 µL
WT1 (Wilm's Tumor 1) (6F-H2), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401714-500 1x 500 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402899-100 1x 100 µL
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940015-500 1x 500 µL
CD56 / NCAM (123C3.D5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details