Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Specifications

Product Name Alternative

Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)

Abbreviation

Recombinant Human CD47 protein, partial (Active)

Gene Name

CD47

UniProt

Q08722

Expression Region

19-139aa

Organism

Homo sapiens (Human)

Target Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. ②Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-7514R-APC-Cy7 100 µL

BAI2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Azlon Cylinder PMP 2L 20ml Graduations
CYL2014 1 Each

Azlon Cylinder PMP 2L 20ml Graduations

Sign In for Pricing
View Details
Rabbit Polyclonal PGD2 Synthase/PTGDS Antibody [mFluor Violet 500 SE]
NB110-59909MFV500 0.1 mL

Rabbit Polyclonal PGD2 Synthase/PTGDS Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Recombinant Rat Secretagogin
7-06335 10 µg

Recombinant Rat Secretagogin

Sign In for Pricing
View Details
PEnCMV-GZMA (human) (1Synonymous mutation) -3xFLAG-SV40-Neo
BZ26636 1 Vial

PEnCMV-GZMA (human) (1Synonymous mutation) -3xFLAG-SV40-Neo

Sign In for Pricing
View Details
ERK1/2 Mouse Monoclonal Antibody (1H4)
MBS8528853-01 0.1 mg

ERK1/2 Mouse Monoclonal Antibody (1H4)

Sign In for Pricing
View Details