Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XCL1, Rat (His)

XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

XCL1 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/xcl1-protein-rat-his.html

Purity

95.0

Smiles

VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG

Molecular Formula

171371 (Gene_ID) P51672 (V22-G114) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL
BNC940396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF640R conjugate, 0.1mg/mL
BNC401104-100 1x 100 µL

PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF640R conjugate, 0.1mg/mL
BNC402085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL
BNC941967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details