Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

I-TAC/CXCL11, Human

CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), belongs to the ELR-negative CXC chemokine family. CXCL11 is produced by a variety of cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs) . CXCL11 signals through CXCR3. CXCL11 is associated with pleiotropic functions including chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects[1][2]. I-TAC/CXCL11 Protein, Human consists of 73 amino acids (F22-F94) and is expressed in E. coli.

Product Specifications

Product Name Alternative

I-TAC/CXCL11 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/i-tac-cxcl11-protein-human.html

Purity

98.0

Smiles

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Molecular Formula

6373 (Gene_ID) O14625 (F22-F94) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Proost P, et al. Proteolytic processing of CXCL11 by CD13/aminopeptidase N impairs CXCR3 and CXCR7 binding and signaling and reduces lymphocyte and endothelial cell migration. Blood. 2007 Jul 1;110 (1) :37-44.|[2]Proost P, et al. Proteolytic processing of CXCL11 by CD13/aminopeptidase N impairs CXCR3 and CXCR7 binding and signaling and reduces lymphocyte and endothelial cell migration. Blood. 2007 Jul 1;110 (1) :37-44.|[3]Qun Gao, et al. CXCL11 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:41-50.|[4]Tat-San Lau, et al. Cancer cell-derived lymphotoxin mediates reciprocal tumour-stromal interactions in human ovarian cancer by inducing CXCL11 in fibroblasts. J Pathol. 2014 Jan;232 (1) :43-56.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant c-Myc (phospho T58) Antibody
RC-16350-01 50 μL

Recombinant c-Myc (phospho T58) Antibody

Sign In for Pricing
View Details
Recombinant c-Myc (phospho T58) Antibody
RC-16350-02 100 µL

Recombinant c-Myc (phospho T58) Antibody

Sign In for Pricing
View Details
Recombinant c-Myc (phospho T58) Antibody
RC-16350-03 1 mL

Recombinant c-Myc (phospho T58) Antibody

Sign In for Pricing
View Details
Arachidonoyl-L-carnitine-d3 (may contain up to 1% of d0)
TRC-A765159-50MG 50 mg

Arachidonoyl-L-carnitine-d3 (may contain up to 1% of d0)

Sign In for Pricing
View Details
Recombinant YY1 Antibody
RN-086-01 50 μL

Recombinant YY1 Antibody

Sign In for Pricing
View Details
Recombinant YY1 Antibody
RN-086-02 100 µL

Recombinant YY1 Antibody

Sign In for Pricing
View Details