I-TAC/CXCL11, Human
CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), belongs to the ELR-negative CXC chemokine family. CXCL11 is produced by a variety of cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs) . CXCL11 signals through CXCR3. CXCL11 is associated with pleiotropic functions including chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects[1][2]. I-TAC/CXCL11 Protein, Human consists of 73 amino acids (F22-F94) and is expressed in E. coli.
Product Specifications
Product Name Alternative
I-TAC/CXCL11 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/i-tac-cxcl11-protein-human.html
Purity
98.0
Smiles
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Molecular Formula
6373 (Gene_ID) O14625 (F22-F94) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Acetoacetyl CoA synthetase (AACS) (NM_023928) Human Tagged ORF Clone Lentiviral Particle
YY2, CT (YY2, ZNF631, Transcription factor YY2, Yin and yang 2, Zinc finger protein 631) (MaxLight 405) discontinued
Canine Telomerase reverse transcriptase, TERT ELISA KIT
Canine Telomerase reverse transcriptase, TERT ELISA KIT