Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Superoxide dismutase [Cu-Zn] (SOD1)

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey SOD1 protein

Gene Name

SOD1

UniProt

Q8HXQ1

Expression Region

2-154aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

AMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-01 0.1 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-02 0.2 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-03 0.5 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-04 1 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-05 5 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor II (F2)
MBS2139535-06 5x 5 mL

Polyclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details