BNIP3/NIP3, Human (His)
BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death[1].
Product Specifications
Product Name Alternative
BNIP3/NIP3 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bnip3-nip3-protein-human-his.html
Purity
98.0
Smiles
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFL
Molecular Formula
664 (Gene_ID) AAH21989.1 (M1-L166) (Accession)
Molecular Weight
Approximately 22-28.0 kDa
References & Citations
[1]Swoboda E, et al. BNIP3 jako nietypowy przedstawiciel rodziny Bcl-2. Cześć 2: Regulacja ekspresji i aktywności BNIP3 oraz jego rola w chorobie nowotworowej [BNIP3 as an atypical representative of the Bcl-2 protein family. Part 2: Regulation of the expression and activity of BNIP3 protein and its role in tumorigenesis]. Postepy Hig Med Dosw (Online) . 2009;63:418-424. Published 2009 Sep 10.|[2]Park CW, et al. BNIP3 is degraded by ULK1-dependent autophagy via MTORC1 and AMPK. Autophagy. 2013;9 (3) :345-360.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470050-100 1x 100 µL
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882747-500 1x 500 µL
TCL1 (T-Cell Marker) (TCL1/2747R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400488-500 1x 500 µL
Topoisomerase I, MT (TOP1MT/488), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041986-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details