Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-A, Rabbit (P. pastoris, His)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived VEGF-A protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-A Protein, Rabbit (P. pastoris, His), Rabbit, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-a-protein-rabbit-p-pastoris-his.html

Purity

98.0

Smiles

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Molecular Formula

/ (Gene_ID) XP_002714743.1 (Y51-R511) (Accession)

Molecular Weight

Approximately 45-66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPKA (NM_002220) Human Recombinant Protein
TP305323 20 µg

ITPKA (NM_002220) Human Recombinant Protein

Sign In for Pricing
View Details
CEACAM6 Polyclonal Antibody
E-AB-12782-01 20 µL

CEACAM6 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM6 Polyclonal Antibody
E-AB-12782-02 60 µL

CEACAM6 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM6 Polyclonal Antibody
E-AB-12782-03 120 µL

CEACAM6 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM6 Polyclonal Antibody
E-AB-12782-04 200 µL

CEACAM6 Polyclonal Antibody

Sign In for Pricing
View Details
B3galnt2 Mouse Gene Knockout Kit (CRISPR)
KN501910 1 Kit

B3galnt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details