Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-A, Rabbit (P. pastoris, His)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived VEGF-A protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-A Protein, Rabbit (P. pastoris, His), Rabbit, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-a-protein-rabbit-p-pastoris-his.html

Purity

98.0

Smiles

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Molecular Formula

/ (Gene_ID) XP_002714743.1 (Y51-R511) (Accession)

Molecular Weight

Approximately 45-66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK2 Recombinant Rabbit Monoclonal Antibody [JG36-23]
ET7108-29 100 µL

IRAK2 Recombinant Rabbit Monoclonal Antibody [JG36-23]

Sign In for Pricing
View Details
AccB7I, 100U
RE1108 100 U

AccB7I, 100U

Sign In for Pricing
View Details
Fmoc-Cys (StBu) Wang Resin
H0370751309.5G 5 g

Fmoc-Cys (StBu) Wang Resin

Sign In for Pricing
View Details
Human MIR3667HG activation kit by CRISPRa
GA117683 1 Kit

Human MIR3667HG activation kit by CRISPRa

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF594 conjugate, 0.1mg/mL
BNC941774-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FRS2 activation kit by CRISPRa
GA107417 1 Kit

Human FRS2 activation kit by CRISPRa

Sign In for Pricing
View Details