Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2H, Human (GST)

UBE2H Protein, a crucial participant in cellular ubiquitination, transfers ubiquitin from the E1 complex to various proteins, including MAEA of the CTLH E3 ubiquitin-protein ligase complex. Versatile in vitro, UBE2H catalyzes both 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its involvement in diverse ubiquitin-related processes. Notably, it demonstrates the capability to ubiquitinate histone H2A in vitro. UBE2H Protein, Human (GST) is the recombinant human-derived UBE2H protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2H Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2h-protein-human-gst.html

Purity

95.07

Smiles

MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

Molecular Formula

7328 (Gene_ID) P62256 (M1-L183) (Accession)

Molecular Weight

Approximately 50.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human NDUFAF3 shRNA (UAS) - Lentiviral human NDUFAF3 shRNA (UAS, iRFP) plasmid
GTR15161848 1 Vial

Lentiviral human NDUFAF3 shRNA (UAS) - Lentiviral human NDUFAF3 shRNA (UAS, iRFP) plasmid

Ask
View Details
Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit
MBS9336267-01 48 Well

Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit

Ask
View Details
Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit
MBS9336267-02 96 Well

Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit

Ask
View Details
Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit
MBS9336267-03 5x 96 Well

Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit

Ask
View Details
Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit
MBS9336267-04 10x 96 Well

Rat E3 ubiquitin-protein ligase MARCH11, MARCH11 ELISA Kit

Ask
View Details
PMCH Polyclonal Antibody
BT-AP13195-01 20 µL

PMCH Polyclonal Antibody

Ask
View Details