Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF)

Product Specifications

CAS Number

9000-83-3

Gene Name

BDNF

UniProt

P23560

Expression Region

19-247aa

Organism

Homo sapiens

Target Sequence

APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Tag

N-terminal 6xHis-Myc-tagged

Source

E.coli

Field of Research

Cardiovascular

Assay Type

Developed Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP7D1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9314R-BF647-01 20 µL

MAP7D1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MAP7D1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9314R-BF647-02 100 µL

MAP7D1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Lentiviral human RGS18 shRNA (UAS) - Lentiviral human RGS18 shRNA (UAS) (100)
GTR15078666 1 Vial

Lentiviral human RGS18 shRNA (UAS) - Lentiviral human RGS18 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)
MBS2123157-01 0.01 mg

Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)

Sign In for Pricing
View Details
Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)
MBS2123157-02 0.05 mg

Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)

Sign In for Pricing
View Details
Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)
MBS2123157-03 0.1 mg

Recombinant Branched Chain Aminotransferase 2, Mitochondrial (BCAT2)

Sign In for Pricing
View Details