Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-mouse-his.html

Purity

95.0

Smiles

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Molecular Formula

54448 (Gene_ID) Q9JLA2 (M1-H160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat SLC4A3 shRNA Plasmid
abx984632-01 150 µg

Rat SLC4A3 shRNA Plasmid

Sign In for Pricing
View Details
Rat SLC4A3 shRNA Plasmid
abx984632-02 300 µg

Rat SLC4A3 shRNA Plasmid

Sign In for Pricing
View Details
ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (PE)
MBS6275027-01 0.2 mL

ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (PE)

Sign In for Pricing
View Details
ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (PE)
MBS6275027-02 5x 0.2 mL

ARHGEF4, CT (ARHGEF4, KIAA1112, Rho guanine nucleotide exchange factor 4, APC-stimulated guanine nucleotide exchange factor 1) (PE)

Sign In for Pricing
View Details
Smim12 (NM_030252) Mouse Tagged ORF Clone Lentiviral Particle
MR200242L4V 200 µL

Smim12 (NM_030252) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal EDA2R/TNFRSF27/XEDAR Antibody [Alexa Fluor 594]
NBP1-76710AF594 0.1 mL

Rabbit Polyclonal EDA2R/TNFRSF27/XEDAR Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details