Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-mouse-his.html

Purity

95.0

Smiles

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Molecular Formula

54448 (Gene_ID) Q9JLA2 (M1-H160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRXRD2/SELZ Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8628R-APC-Cy5.5 100 µL

TRXRD2/SELZ Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
ACADVL (HRP)
554194-01 50 µg

ACADVL (HRP)

Sign In for Pricing
View Details
ACADVL (HRP)
554194-02 100 µg

ACADVL (HRP)

Sign In for Pricing
View Details
MMP24, ID (Matrix Metalloproteinase-24, MMP-24, Membrane-type Matrix Metalloproteinase 5, MT-MMP 5, MTMMP5, Membrane-type-5 Matrix Metalloproteinase, MT5-MMP, MT5MMP, MT5MMP) (APC) discontinued
M2436-04-APC 200 µL

MMP24, ID (Matrix Metalloproteinase-24, MMP-24, Membrane-type Matrix Metalloproteinase 5, MT-MMP 5, MTMMP5, Membrane-type-5 Matrix Metalloproteinase, MT5-MMP, MT5MMP, MT5MMP) (APC) discontinued

Sign In for Pricing
View Details
Rabbit Anti-SIAE antibody
SL17480R-01 50 µL

Rabbit Anti-SIAE antibody

Sign In for Pricing
View Details
Rabbit Anti-SIAE antibody
SL17480R-02 100 µL

Rabbit Anti-SIAE antibody

Sign In for Pricing
View Details