Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-mouse-his.html

Purity

95.0

Smiles

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Molecular Formula

54448 (Gene_ID) Q9JLA2 (M1-H160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep PRL (Prolactin) ELISA Kit
MBS8807263-01 48 Strip Well

Sheep PRL (Prolactin) ELISA Kit

Sign In for Pricing
View Details
Sheep PRL (Prolactin) ELISA Kit
MBS8807263-02 96 Strip Well

Sheep PRL (Prolactin) ELISA Kit

Sign In for Pricing
View Details
Sheep PRL (Prolactin) ELISA Kit
MBS8807263-03 5x 96 Strip Well

Sheep PRL (Prolactin) ELISA Kit

Sign In for Pricing
View Details
Sheep PRL (Prolactin) ELISA Kit
MBS8807263-04 10x 96 Strip Well

Sheep PRL (Prolactin) ELISA Kit

Sign In for Pricing
View Details
CDK2AP2P2 Protein Vector (Human) (pPM-C-HA)
PV068507 500 ng

CDK2AP2P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SUSD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45910111 3x 1.0 µg

SUSD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details