Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-mouse-his.html

Purity

95.0

Smiles

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Molecular Formula

54448 (Gene_ID) Q9JLA2 (M1-H160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cx3cl1 (NM_009142) Mouse Tagged ORF Clone Lentiviral Particle
MR206171L3V 200 µL

Cx3cl1 (NM_009142) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr951 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4195504 1.0 µg DNA

Olfr951 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)
MBS2130300-01 0.1 mL

APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)
MBS2130300-02 0.2 mL

APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)
MBS2130300-03 0.5 mL

APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)
MBS2130300-04 1 mL

APC Linked Polyclonal Antibody to Aquaporin 3, Gill Blood Group (AQP3)

Sign In for Pricing
View Details