Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 alpha/IL-1F6, Mouse (His)

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-alpha-il-1f6-protein-mouse-his.html

Purity

95.0

Smiles

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Molecular Formula

54448 (Gene_ID) Q9JLA2 (M1-H160) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRAT1 Polyclonal Antibody
MBS8567602-01 0.1 mL

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
BRAT1 Polyclonal Antibody
MBS8567602-02 0.1 mL (AF405L)

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
BRAT1 Polyclonal Antibody
MBS8567602-03 0.1 mL (AF405S)

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
BRAT1 Polyclonal Antibody
MBS8567602-04 0.1 mL (AF610)

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
BRAT1 Polyclonal Antibody
MBS8567602-05 0.1 mL (AF635)

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details
BRAT1 Polyclonal Antibody
MBS8567602-06 0.1 mL (APC)

BRAT1 Polyclonal Antibody

Sign In for Pricing
View Details