AGR3, Mouse (HEK293, His)
AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.
Product Specifications
Product Name Alternative
AGR3 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/agr3-protein-mouse-hek293-his.html
Purity
95.00
Smiles
IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSELHHHHHH
Molecular Formula
403205 (Gene_ID) Q8R3W7 (I21-L165) (Accession)
Molecular Weight
Approximately 16-18 kDa
References & Citations
[1]Obacz J, et al. Extracellular AGR3 regulates breast cancer cells migration via Src signaling. Oncol Lett. 2019 Nov;18 (5) :4449-4456.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-100 1x 100 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681119-500 1x 500 µL
TGFalpha (TGFA/1119), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details