Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB2, Human (His)

GABRB2 protein is an important component of heteropentameric GABA receptors that form ligand-gated chloride channels. It plays a crucial role in establishing functional inhibitory GABAergic synapses, contributing to synaptic depression. GABRB2 Protein, Human (His) is the recombinant human-derived GABRB2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GABRB2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabrb2-protein-human-his.html

Purity

93.00

Smiles

SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Molecular Formula

2561 (Gene_ID) P47870-1 (S26-Y244) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAM domain-containing protein 2 (MAMDC2) Human ELISA Kit
E8369 96 Tests

MAM domain-containing protein 2 (MAMDC2) Human ELISA Kit

Sign In for Pricing
View Details
Tyrosinase Double Nickase Plasmid (m)
sc-423566-NIC 20 µg

Tyrosinase Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Hsa-miR-1237-3p miRNA Agomir
orb1920838-01 5 nmol

Hsa-miR-1237-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-1237-3p miRNA Agomir
orb1920838-02 10 nmol

Hsa-miR-1237-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-1237-3p miRNA Agomir
orb1920838-03 20 nmol

Hsa-miR-1237-3p miRNA Agomir

Sign In for Pricing
View Details
αB-crystallin (C-8) : m-IgG Fc BP-HRP Bundle
sc-539945 1 Kit

αB-crystallin (C-8) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details