Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165

Human Vascular Endothelial Growth Factor VEGF165, a 23 kDa protein consisting of 165 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR) . Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extra villous trophoblast. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemo attractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homo-dimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF

Product Specifications

Synonyms

Vascular endothelial growth factor A; VEGFA; VPF; VEGF; MVCD1

NCBI Gene ID

7422

UniProt

P15692

Accession Number

NP_001020537.2

Accession Number mRNA

NM_001025366.2

Chromosomal Location

6p12

Reactivity

Human

Cross Reactivity

Human

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Assay Protocol

The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Purity

> 90% by SDS-PAGE

Bioactivity

The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for VEGF165 has been determined to be in the range of 1-4 ng/ml.

Length

165

Form

Lyophilized

Buffer

50mM acetic acid

Reconstitution

50mM acetic acid

Molecular Weight

45.0 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF165 should be stored in working aliquots at -20°C.

Host or Source

Insect cells

N Terminal Sequence

APMAEGG

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3I Rabbit Polyclonal Antibody
orb2953395-01 50 µg

EIF3I Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3I Rabbit Polyclonal Antibody
orb2953395-02 100 µg

EIF3I Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GENLISA™ Human TransMembrane Protein 119 (TMEM119) ELISA
KBH6313 1x 96 Well

GENLISA™ Human TransMembrane Protein 119 (TMEM119) ELISA

Sign In for Pricing
View Details
Lymphoid Enhancer Binding Factor 1 (LEF1) Antibody
abx026579-01 80 µL

Lymphoid Enhancer Binding Factor 1 (LEF1) Antibody

Sign In for Pricing
View Details
Lymphoid Enhancer Binding Factor 1 (LEF1) Antibody
abx026579-02 400 µL

Lymphoid Enhancer Binding Factor 1 (LEF1) Antibody

Sign In for Pricing
View Details
12-Phenyl-11H-indolo[2,3-a]carbazole
OR89893-01 1 g

12-Phenyl-11H-indolo[2,3-a]carbazole

Sign In for Pricing
View Details