Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164

Mouse Vascular Endothelial Growth Factor164 (VEGF164), a 19,2 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1) . Consistent with the endothelial cell-specific action of VEGF164, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144, and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogeneity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exists and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.

Product Specifications

Synonyms

Vascular endothelial growth factor A; Vegfa; Vpf; Vegf; Vegf164

NCBI Gene ID

22339

UniProt

Q00731

Accession Number

NP_001020421

Accession Number mRNA

NM_001025250

Chromosomal Location

17C; 17 24.2cM

Reactivity

Mouse

Cross Reactivity

Mouse

Sequence

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Assay Protocol

The lyophilized VEGF164 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Endotoxin

< 0.1 ng per µg of mouse VEGF166

Purity

> 90% by SDS-PAGE

Bioactivity

The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for VEGF164 has been determined to be in the range of 1-5 ng/ml.

Length

164

Form

Lyophilized

Buffer

50mM acetic acid

Reconstitution

50 mM aceetic acid

Molecular Weight

38,4 kDa

Storage Conditions

Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF164 should be stored in working aliquots at -20°C

Host or Source

E. coli

N Terminal Sequence

APTTEGE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bile salts
GX6607-10g 10 g

Bile salts

Sign In for Pricing
View Details
Phospho-AP-1 (T93) Polyclonal Antibody
JOT-PHS00017-01 50ul

Phospho-AP-1 (T93) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-AP-1 (T93) Polyclonal Antibody
JOT-PHS00017-02 100ul

Phospho-AP-1 (T93) Polyclonal Antibody

Sign In for Pricing
View Details
CD4 (pS433) Antibody
E38PA6353 100 µL

CD4 (pS433) Antibody

Sign In for Pricing
View Details
Human Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS459364-01 48 Tests

Human Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit
MBS459364-02 96 Tests

Human Fibronectin Type III Domain Containing Protein 5 (FNDC5) ELISA Kit

Sign In for Pricing
View Details