Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Mouse (HEK293, His)

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-mouse-hek293-his.html

Purity

95.0

Smiles

FSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

67374 (Gene_ID) Q9JI59 (F29-N236) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-01 0.5 mg (E-Coli)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details
Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-02 0.05 mg (Baculovirus)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details
Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-03 0.5 mg (Yeast)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details
Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-04 0.05 mg (Mammalian-Cell)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details
Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-05 1 mg (E-Coli)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details
Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial
MBS1383873-06 0.1 mg (Baculovirus)

Recombinant Human Interleukin-10 receptor subunit beta (IL10RB), partial

Ask
View Details