CT83, Human (His, B2M)
The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.
Product Specifications
Product Name Alternative
CT83 Protein, Human (His, B2M), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ct83-protein-human-his-b2m.html
Purity
90.00
Smiles
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Molecular Formula
203413 (Gene_ID) Q5H943 (M1-T113) (Accession)
Molecular Weight
Approximately 26.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Aim1l (Crybg2) (NM_001162970) Mouse Tagged ORF Clone Lentiviral Particle
APC-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
APC-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
APC-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)
APC-Linked Polyclonal Antibody to Retinol Binding Protein 3, Interstitial (RBP3)