Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT83, Human (His, B2M)

The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.

Product Specifications

Product Name Alternative

CT83 Protein, Human (His, B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ct83-protein-human-his-b2m.html

Purity

90.00

Smiles

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Molecular Formula

203413 (Gene_ID) Q5H943 (M1-T113) (Accession)

Molecular Weight

Approximately 26.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Ras Associated Protein 1B, Rap 1b ELISA KIT
E4294hu-01 48 Well

Human Ras Associated Protein 1B, Rap 1b ELISA KIT

Ask
View Details
Human Ras Associated Protein 1B, Rap 1b ELISA KIT
E4294hu-02 96 Well

Human Ras Associated Protein 1B, Rap 1b ELISA KIT

Ask
View Details
Human Ras Associated Protein 1B, Rap 1b ELISA KIT
E4294hu-03 5x 96 Tests

Human Ras Associated Protein 1B, Rap 1b ELISA KIT

Ask
View Details
Human Ras Associated Protein 1B, Rap 1b ELISA KIT
E4294hu-04 10x 96 Tests

Human Ras Associated Protein 1B, Rap 1b ELISA KIT

Ask
View Details
Mouse Natural Cytotoxicity Triggering Receptor1 (NKP46) ELISA Kit
YP-W23772-01 48 Tests

Mouse Natural Cytotoxicity Triggering Receptor1 (NKP46) ELISA Kit

Ask
View Details
Mouse Natural Cytotoxicity Triggering Receptor1 (NKP46) ELISA Kit
YP-W23772-02 96 Tests

Mouse Natural Cytotoxicity Triggering Receptor1 (NKP46) ELISA Kit

Ask
View Details