Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT83, Human (His, B2M)

The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.

Product Specifications

Product Name Alternative

CT83 Protein, Human (His, B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ct83-protein-human-his-b2m.html

Purity

90.00

Smiles

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Molecular Formula

203413 (Gene_ID) Q5H943 (M1-T113) (Accession)

Molecular Weight

Approximately 26.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Prolactin receptor Antibody, mAb, Rabbit
A03875-100 100 µL

Prolactin receptor Antibody, mAb, Rabbit

Ask
View Details
3-Phenylpropionic acid 99+%
232137-01 100 g

3-Phenylpropionic acid 99+%

Ask
View Details
3-Phenylpropionic acid 99+%
232137-02 250 g

3-Phenylpropionic acid 99+%

Ask
View Details
3-Phenylpropionic acid 99+%
232137-03 1 Kg

3-Phenylpropionic acid 99+%

Ask
View Details
3-Phenylpropionic acid 99+%
232137-04 5 Kg

3-Phenylpropionic acid 99+%

Ask
View Details
Smac (Second Mitochondria-derived Activator of Caspase, Smac Protein, 0610041G12Rik, DBOH, Direct IAP-binding Protein with Low pI, Diablo, Diablo Homolog (Drosophila), Diablo Homolog, Diablo Homolog Mitochondrial Precursor, DIABLO S, DIABLO-S, FLJ10537, FLJ25049, Mitochondrial Smac Protein, SMAC3, SMAC 3)
S1014-49L 200 µL

Smac (Second Mitochondria-derived Activator of Caspase, Smac Protein, 0610041G12Rik, DBOH, Direct IAP-binding Protein with Low pI, Diablo, Diablo Homolog (Drosophila), Diablo Homolog, Diablo Homolog Mitochondrial Precursor, DIABLO S, DIABLO-S, FLJ10537, FLJ25049, Mitochondrial Smac Protein, SMAC3, SMAC 3)

Ask
View Details