Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urine-10

The Cypress Diagnostics URINE 1 – 10 PARAMETERS reagent strips are an in vitro diagnostic medical device intended to be used for the semi-quantitative determination of Urobilinogen, Glucose, Bilirubin, Ketones (Acetoacetic Acid), Specific Gravity, Blood, pH, Protein, Nitrite and Leukocytes in human urine. The test can be read either visually or with the CYANStrip Mini analyzer. The determination of these parameters is intended to be used to aid in the diagnosis of metabolic, renal, hepatic, urinary tract or systemic diseases and disorders in patients showing typical symptoms of the mentioned disorders. This kit is intended to be used by healthcare professionals in a laboratory-based testing environment.

Product Specifications

Certification

CE

Storage Temperature

2 - 30 °C

Notes

CYPRESS DIAGNOSTICS Urine Strips are dip-and-read test strips that measure urobilinogen, glucose, bilirubin, ketones (acetoacetic acid), specific gravity, blood, pH, protein, nitrite, and leukocytes in urine. These test results can provide important information about carbohydrate metabolism, kidney and liver function, acid-base balance, urine concentration, and the presence of urinary tract infections.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)
138509-AF 100 µg

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-4 Antibody [mFluor Violet 500 SE]
NBP1-77208MFV500 0.1 mL

Rabbit Polyclonal Caspase-4 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
AKT2 (specific) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8B7]
AM00109PU-N 100 µg

AKT2 (specific) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8B7]

Sign In for Pricing
View Details
Purified Anti-Human CD45 (HI30)
orb1215051 100 µg

Purified Anti-Human CD45 (HI30)

Sign In for Pricing
View Details
Mouse Monoclonal PD-1 Antibody (7A11B1)
NBP1-75518-0.025mg 0.025 mg

Mouse Monoclonal PD-1 Antibody (7A11B1)

Sign In for Pricing
View Details
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
PH00241-01 1 mg

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

Sign In for Pricing
View Details