Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial

Product Specifications

Product Name Alternative

Protein BSCv

Abbreviation

Recombinant Human APMAP protein, partial

Gene Name

APMAP

UniProt

Q9HDC9

Expression Region

62-416aa

Organism

Homo sapiens (Human)

Target Sequence

ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human IL-17F mAb (MTF912), biotin
3522-6-1000 1 mg

Anti-human IL-17F mAb (MTF912), biotin

Sign In for Pricing
View Details
Laminin-5 (P3H9-2) PE
sc-13586 PE 200 µg/mL

Laminin-5 (P3H9-2) PE

Sign In for Pricing
View Details
MAP3K6, CT (Mitogen-activated Protein Kinase Kinase Kinase 6, MAPKKK6, Apoptosis Signal-regulating Kinase 2, ASK2, MEKK6) (Azide free) (HRP) discontinued
M2867-54C-HRP 200 µL

MAP3K6, CT (Mitogen-activated Protein Kinase Kinase Kinase 6, MAPKKK6, Apoptosis Signal-regulating Kinase 2, ASK2, MEKK6) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PCMV-YBX1-3xHA-Neo Plasmid
PVT66973 2 µg

PCMV-YBX1-3xHA-Neo Plasmid

Sign In for Pricing
View Details
ABHD12B, Recombinant, Human, aa1-255, His-Tag (Abhydrolase Domain Containing 12B, BEM46L3, C14_5314)
217918-01 100 µg

ABHD12B, Recombinant, Human, aa1-255, His-Tag (Abhydrolase Domain Containing 12B, BEM46L3, C14_5314)

Sign In for Pricing
View Details
ABHD12B, Recombinant, Human, aa1-255, His-Tag (Abhydrolase Domain Containing 12B, BEM46L3, C14_5314)
217918-02 500 µg

ABHD12B, Recombinant, Human, aa1-255, His-Tag (Abhydrolase Domain Containing 12B, BEM46L3, C14_5314)

Sign In for Pricing
View Details