Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAMP1 Rabbit pAb (APR30428N)

Product Specifications

Background

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs) . RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAMP1 Rabbit pAb (APR30428N) .

Synonyms

RAMP1

Gene ID

10267

UniProt

O60894

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 17KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10267

Uniprot URL

https://www.uniprot.org/uniprot/O60894

AA Sequence

CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lrrc17 Mouse qPCR Primer Pair (NM_028977)
MP220867 200 Reactions

Lrrc17 Mouse qPCR Primer Pair (NM_028977)

Ask
View Details
ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (MaxLight 750)
MBS6370505-01 0.1 mL

ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (MaxLight 750)

Ask
View Details
ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (MaxLight 750)
MBS6370505-02 5x 0.1 mL

ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (MaxLight 750)

Ask
View Details
TAGLN siRNA Oligos set (Human)
46102171 3x 5 nmol

TAGLN siRNA Oligos set (Human)

Ask
View Details
Mucin 1 (Mucin-1, MUC1, MUC-1, Breast Carcinoma-associated Antigen DF3, Carcinoma Associated Mucin, CD227, DF3, Episialin, Epithelial Membrane Antigen, EMA, H23 Antigen, H23AG, HGNC:7508, KL-6, MAM6, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, PEMT, Tumor Associated Epithelial Membrane Antigen, Tumor-associated Mucin) (HRP) discontinued
M4700-06D-HRP 100 µL

Mucin 1 (Mucin-1, MUC1, MUC-1, Breast Carcinoma-associated Antigen DF3, Carcinoma Associated Mucin, CD227, DF3, Episialin, Epithelial Membrane Antigen, EMA, H23 Antigen, H23AG, HGNC:7508, KL-6, MAM6, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, PEMT, Tumor Associated Epithelial Membrane Antigen, Tumor-associated Mucin) (HRP) discontinued

Ask
View Details
Lentiviral mouse Ube3b shRNA (UAS) - Lentiviral mouseUbe3b shRNA (UAS, GFP) (25)
GTR15250340 1 Vial

Lentiviral mouse Ube3b shRNA (UAS) - Lentiviral mouseUbe3b shRNA (UAS, GFP) (25)

Ask
View Details