Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK19 Rabbit pAb (APR30418N)

Product Specifications

Background

This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK19 Rabbit pAb (APR29949N9) .

Synonyms

CDK19; CDC2L6; CDK11; bA346C16.3

Gene ID

23097

UniProt

Q9BWU1

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/56kDa Observed MW: 57KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23097

Uniprot URL

https://www.uniprot.org/uniprot/Q9BWU1

AA Sequence

QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptopodin (SYNPO) Human Gene Knockout Kit (CRISPR)
KN414922 1 Kit

Synaptopodin (SYNPO) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human R-Spondin 1/RSPO1 Protein (His Tag)
PKSH031269 100 µg

Recombinant Human R-Spondin 1/RSPO1 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS623582 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®594 Conjugate
#29105 1x 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®594 Conjugate

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS622251 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA369017 100 µL

CARD12 (NLRC4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details