Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2AX Rabbit pAb (APR30414N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H2AX Rabbit pAb (APR18336N7) .

Synonyms

H2A.X; H2A/X; H2AX; Histone H2AX; H2AFX; histone H2AX; gamma H2A.X; γH2AX

Gene ID

3014

UniProt

P16104

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 15KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3014

Uniprot URL

https://www.uniprot.org/uniprot/P16104

AA Sequence

VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-01 0.02 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-02 0.1 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-03 0.02 mg (Yeast)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-04 0.1 mg (Yeast)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-05 0.02 mg (Baculovirus)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region
MBS1117481-06 1 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 8.2 kDa protein in HE65-PK2 intergenic region

Ask
View Details