Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGC1α Rabbit pAb (APR30413N)

Product Specifications

Background

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs) . It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Synonyms

PPARGC1A; LEM6; PGC-1 (alpha) ; PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; PPARG coactivator 1 alpha; PGC1 alpha

Gene ID

10891

UniProt

Q9UBK2

Cellular Locus

Cytoplasm, Nucleus, PML body

Applications

IF (mouse cells, Rattus norvegicus) WB (Rabbit cerebral microvascular endothelial cells, Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) IHC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/30kDa/31kDa/33kDa/77kDa/89kDa/91kDa Observed MW: 91KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PGC1α Rabbit pAb (APR18975N8) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10891

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBK2

AA Sequence

FGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Yipf2 (NM_001014208) Rat Tagged ORF Clone Lentiviral Particle
RR212938L4V 200 µL

Yipf2 (NM_001014208) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 750)
MBS6240023-01 0.1 mL

PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 750)

Ask
View Details
PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 750)
MBS6240023-02 5x 0.1 mL

PPARBP (Mediator Complex Subunit 1, CRSP1, CRSP200, DRIP205, DRIP230, MGC71488, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (MaxLight 750)

Ask
View Details
DPPE PEG-Amine (2 kDa)
VCar-Ly114 100 mg

DPPE PEG-Amine (2 kDa)

Ask
View Details
Human COPS3 (NM_001199125) AAV Particle
RC231212A1V 250 µL

Human COPS3 (NM_001199125) AAV Particle

Ask
View Details