Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGC1α Rabbit pAb (APR30413N)

Product Specifications

Background

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs) . It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PGC1α Rabbit pAb (APR18975N8) .

Synonyms

PPARGC1A; LEM6; PGC-1 (alpha) ; PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; PPARG coactivator 1 alpha; PGC1 alpha

Gene ID

10891

UniProt

Q9UBK2

Cellular Locus

Cytoplasm, Nucleus, PML body

Applications

IF (mouse cells, Rattus norvegicus) WB (Rabbit cerebral microvascular endothelial cells, Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) IHC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/30kDa/31kDa/33kDa/77kDa/89kDa/91kDa Observed MW: 91KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10891

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBK2

AA Sequence

FGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 Mouse Monoclonal Antibody [Clone ID: Tük4]
SM1066PT 25 µg

CD14 Mouse Monoclonal Antibody [Clone ID: Tük4]

Sign In for Pricing
View Details
COMMD8 Adenovirus (Rat)
16615056 1.0 mL

COMMD8 Adenovirus (Rat)

Sign In for Pricing
View Details
PDS5B (Sister chromatid cohesion protein PDS5 homolog B, Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3)
327803 100 µL

PDS5B (Sister chromatid cohesion protein PDS5 homolog B, Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus DNA topoisomerase 1 (topA), partial
MBS1369964 Inquire

Recombinant Staphylococcus aureus DNA topoisomerase 1 (topA), partial

Sign In for Pricing
View Details
Periplakin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-22860R-BF405 100 µL

Periplakin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MTUS2 (NM_015233) Human Tagged ORF Clone
RC219139 10 µg

MTUS2 (NM_015233) Human Tagged ORF Clone

Sign In for Pricing
View Details