Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P38 MAPK Rabbit pAb (APR30409N)

Product Specifications

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Synonyms

MAPK14; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; PRKM14; PRKM15; RK; SAPK2A; p38; p38ALPHA; p38 MAPK

Gene ID

1432

UniProt

Q16539

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Raw264.7, HepG2, Mouse, Homo sapiens, Danio rerio, Mus musculus, Rattus norvegicus) IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/34kDa/35kDa/41kDa Observed MW: 38KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p38 MAPK Rabbit pAb (APR30409N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1432

Uniprot URL

https://www.uniprot.org/uniprot/Q16539

AA Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Epn1 Mouse qPCR Primer Pair (NM_010147)
MP204305 200 Reactions

Epn1 Mouse qPCR Primer Pair (NM_010147)

Ask
View Details
CD22 Rabbit mAb
MBS4752638-01 0.1 mL

CD22 Rabbit mAb

Ask
View Details
CD22 Rabbit mAb
MBS4752638-02 5x 0.1 mL

CD22 Rabbit mAb

Ask
View Details
Guinea pig Thymic Stromal Lymphopoietin (TSLP) ELISA Kit
NSL0131Gp 96 Well

Guinea pig Thymic Stromal Lymphopoietin (TSLP) ELISA Kit

Ask
View Details
HLA-DMB, ID (HLA-DMB, DMB, RING7, HLA class II histocompatibility antigen, DM beta chain, MHC class II antigen DMB, Really interesting new gene 7 protein) (MaxLight 490)
MBS6307061-01 0.1 mL

HLA-DMB, ID (HLA-DMB, DMB, RING7, HLA class II histocompatibility antigen, DM beta chain, MHC class II antigen DMB, Really interesting new gene 7 protein) (MaxLight 490)

Ask
View Details
HLA-DMB, ID (HLA-DMB, DMB, RING7, HLA class II histocompatibility antigen, DM beta chain, MHC class II antigen DMB, Really interesting new gene 7 protein) (MaxLight 490)
MBS6307061-02 5x 0.1 mL

HLA-DMB, ID (HLA-DMB, DMB, RING7, HLA class II histocompatibility antigen, DM beta chain, MHC class II antigen DMB, Really interesting new gene 7 protein) (MaxLight 490)

Ask
View Details