Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] HIF1AN/FIH1 Rabbit pAb (APR30390N)

Product Specifications

Background

Hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD. Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] HIF1AN/FIH1 Rabbit pAb (APR30390N) .

Synonyms

HIF1AN; FIH1

Gene ID

55662

UniProt

Q9NWT6

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Applications

WB (fenugreek, Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55662

Uniprot URL

https://www.uniprot.org/uniprot/Q9NWT6

AA Sequence

MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM33 Protein Vector (Mouse) (pPB-C-His)
PV152338 500 ng

ADAM33 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse FGF22 shRNA Plasmid
abx975976-01 150 µg

Mouse FGF22 shRNA Plasmid

Sign In for Pricing
View Details
Mouse FGF22 shRNA Plasmid
abx975976-02 300 µg

Mouse FGF22 shRNA Plasmid

Sign In for Pricing
View Details
J Young Wilmad Precision NMR Tube With 5mm NMR Valve 400mhz 5 Long
NMR1201 1 Each

J Young Wilmad Precision NMR Tube With 5mm NMR Valve 400mhz 5 Long

Sign In for Pricing
View Details
Lentiviral human GTF3C2 sgRNA gene knockout kit - Lentiviral human GTF3C2 sgRNA gene knockout kit (100)
GTR15362575 1 Vial

Lentiviral human GTF3C2 sgRNA gene knockout kit - Lentiviral human GTF3C2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MUC16 Recombinant Antibody, RBITC Conjugated
bsm-62912R-RBITC-01 20 µL

MUC16 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details