Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUR77 Rabbit pAb (APR30386N)

Product Specifications

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUR77 Rabbit pAb (APR30386N) .

Synonyms

NR4A1; GFRP1; HMR; N10; NAK-1; NGFIB; NP10; NUR77; TR3

Gene ID

3164

UniProt

P22736

Cellular Locus

Cytoplasm, Nucleus

Applications

IHC (Homo sapiens, Rattus norvegicus) WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/64kDa/65kDa Observed MW: 64KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3164

Uniprot URL

https://www.uniprot.org/uniprot/P22736

AA Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS708454 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
GPR137C Antibody
8G264-AAT 50 µg

GPR137C Antibody

Sign In for Pricing
View Details
IFluor® 555 hydrazide
1083-AAT 1 mg

IFluor® 555 hydrazide

Sign In for Pricing
View Details
MEOX2 Antibody
8C10662-AAT 50 µg

MEOX2 Antibody

Sign In for Pricing
View Details
Dichloroacetic Acid
TRC-D431825-25G 25 g

Dichloroacetic Acid

Sign In for Pricing
View Details
Recombinant Mouse 14-3-3 epsilon/YWHAE Protein (GST Tag)
PKSM040545 100 µg

Recombinant Mouse 14-3-3 epsilon/YWHAE Protein (GST Tag)

Sign In for Pricing
View Details