Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUR77 Rabbit pAb (APR30386N)

Product Specifications

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUR77 Rabbit pAb (APR30386N) .

Synonyms

NR4A1; GFRP1; HMR; N10; NAK-1; NGFIB; NP10; NUR77; TR3

Gene ID

3164

UniProt

P22736

Cellular Locus

Cytoplasm, Nucleus

Applications

IHC (Homo sapiens, Rattus norvegicus) WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/64kDa/65kDa Observed MW: 64KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3164

Uniprot URL

https://www.uniprot.org/uniprot/P22736

AA Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody
TA370013 100 µL

Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB513946 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Human C4orf33 activation kit by CRISPRa
GA115174 1 Kit

Human C4orf33 activation kit by CRISPRa

Sign In for Pricing
View Details
Heme oxygenase 2 (HMOX2) (NM_001127206) Human Over-expression Lysate
LC426709 20 µg

Heme oxygenase 2 (HMOX2) (NM_001127206) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565601 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
Human ABCG5 activation kit by CRISPRa
GA112027 1 Kit

Human ABCG5 activation kit by CRISPRa

Sign In for Pricing
View Details