Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCN2 Rabbit pAb (APR30317N)

Product Specifications

Background

This gene encodes a member of a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2), resulting in the downregulaton of protein synthesis. The encoded protein responds to amino acid deprivation by binding uncharged transfer RNAs. It may also be activated by glucose deprivation and viral infection. Mutations in this gene have been found in individuals suffering from autosomal recessive pulmonary venoocclusive-disease-2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GCN2 Rabbit pAb (APR19239N8) .

Synonyms

EIF2AK4; GCN2; PVOD2

Gene ID

440275

UniProt

Q9P2K8

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa/183kDa/186kDa Observed MW: 187kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=440275

Uniprot URL

https://www.uniprot.org/uniprot/Q9P2K8

AA Sequence

MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQRRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPK Antibody
orb2808995 100 µL

HNRNPK Antibody

Sign In for Pricing
View Details
DMWD Polyclonal Antibody, HRP Conjugated
bs-13042R-HRP 100 µL

DMWD Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
FBN1 Knockout jurkat Polyclonal Cells
ARG13045 1 Million

FBN1 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
MUC1-T1224 (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen,
MBS6322882-01 0.2 mL

MUC1-T1224 (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen,

Sign In for Pricing
View Details
MUC1-T1224 (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen,
MBS6322882-02 5x 0.2 mL

MUC1-T1224 (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen,

Sign In for Pricing
View Details
Chst5 3'UTR GFP Stable Cell Line
TU252344 1.0 mL

Chst5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details