Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOS1 Rabbit pAb (APR30313N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOS1 Rabbit pAb (APR30313N) .

Synonyms

NOS1; IHPS1; N-NOS; NC-NOS; NOS; bNOS; nNOS

Gene ID

4842

UniProt

P29475

Cellular Locus

Cell membrane, Cell projection, Peripheral membrane protein, dendritic spine, sarcolemma

Applications

IF (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa/125kDa/148kDa/160kDa/164kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4842

Uniprot URL

https://www.uniprot.org/uniprot/P29475

AA Sequence

MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey ADAM10 ELISA Kit
EMKA0734 96 Tests

Monkey ADAM10 ELISA Kit

Sign In for Pricing
View Details
Pigeon High Density Lipoprotein 1 (HDL1) ELISA Kit
MBS9912070 Inquire

Pigeon High Density Lipoprotein 1 (HDL1) ELISA Kit

Sign In for Pricing
View Details
RIPK1, NT (RIPK1, RIP, RIP1, Receptor-interacting serine/threonine-protein kinase 1, Cell death protein RIP, Receptor-interacting protein 1, Serine/threonine-protein kinase RIP) (MaxLight 750)
MBS6342190-01 0.1 mL

RIPK1, NT (RIPK1, RIP, RIP1, Receptor-interacting serine/threonine-protein kinase 1, Cell death protein RIP, Receptor-interacting protein 1, Serine/threonine-protein kinase RIP) (MaxLight 750)

Sign In for Pricing
View Details
RIPK1, NT (RIPK1, RIP, RIP1, Receptor-interacting serine/threonine-protein kinase 1, Cell death protein RIP, Receptor-interacting protein 1, Serine/threonine-protein kinase RIP) (MaxLight 750)
MBS6342190-02 5x 0.1 mL

RIPK1, NT (RIPK1, RIP, RIP1, Receptor-interacting serine/threonine-protein kinase 1, Cell death protein RIP, Receptor-interacting protein 1, Serine/threonine-protein kinase RIP) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral mouse Snx27 shRNA (UAS) - Lentiviral mouse Snx27 shRNA (UAS, RFP) plasmid
GTR15185293 1 Vial

Lentiviral mouse Snx27 shRNA (UAS) - Lentiviral mouse Snx27 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) FEZF1 Polyclonal Antibody
MBS7191231 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) FEZF1 Polyclonal Antibody

Sign In for Pricing
View Details