Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCN2 Rabbit pAb (APR30260N)

Product Specifications

Background

This gene encodes a member of a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2), resulting in the downregulaton of protein synthesis. The encoded protein responds to amino acid deprivation by binding uncharged transfer RNAs. It may also be activated by glucose deprivation and viral infection. Mutations in this gene have been found in individuals suffering from autosomal recessive pulmonary venoocclusive-disease-2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GCN2 Rabbit pAb (APR30260N) .

Synonyms

EIF2AK4; GCN2; PVOD2

Gene ID

440275

UniProt

Q9P2K8

Applications

WB (Human bladder cancer cells)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa/183kDa/186kDa Observed MW: 220kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=440275

Uniprot URL

https://www.uniprot.org/uniprot/Q9P2K8

AA Sequence

MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQRRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zw10 3'UTR Luciferase Stable Cell Line
TU123052 1.0 mL

Zw10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Vanillylmandelic acid (VMA) ELISA Kit
orb2657142-01 48 Tests

Human Vanillylmandelic acid (VMA) ELISA Kit

Sign In for Pricing
View Details
Human Vanillylmandelic acid (VMA) ELISA Kit
orb2657142-02 96 Tests

Human Vanillylmandelic acid (VMA) ELISA Kit

Sign In for Pricing
View Details
EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 gamma, 52kD, EIF2, EIF2G, EIF2gamma, eIF-2gA) (MaxLight 650)
MBS6227346-01 0.1 mL

EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 gamma, 52kD, EIF2, EIF2G, EIF2gamma, eIF-2gA) (MaxLight 650)

Sign In for Pricing
View Details
EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 gamma, 52kD, EIF2, EIF2G, EIF2gamma, eIF-2gA) (MaxLight 650)
MBS6227346-02 5x 0.1 mL

EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 gamma, 52kD, EIF2, EIF2G, EIF2gamma, eIF-2gA) (MaxLight 650)

Sign In for Pricing
View Details
UBE3C Antibody - N-terminal region
ARP43163_P050-25UL 25 µL

UBE3C Antibody - N-terminal region

Sign In for Pricing
View Details