Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calbindin Rabbit pAb (APR30171N)

Product Specifications

Background

The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Calbindin Rabbit pAb (APR30171N) .

Synonyms

CALB1; CALB; D-28K; calbindin; Calbindin

Gene ID

793

UniProt

P05937

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=793

Uniprot URL

https://www.uniprot.org/uniprot/P05937

AA Sequence

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CHCHD1 Antibody [DyLight 594]
NBP3-06218DL594 0.1 mL

Rabbit Polyclonal CHCHD1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Trifluoroacetaldehyde Ethyl Hemiacetal
166935 1 g

Trifluoroacetaldehyde Ethyl Hemiacetal

Sign In for Pricing
View Details
FITC-linked Antibody to Apolipoprotein A1 (APOA1)
MBS2015526-01 0.1 mL

FITC-linked Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details
FITC-linked Antibody to Apolipoprotein A1 (APOA1)
MBS2015526-02 0.2 mL

FITC-linked Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details
FITC-linked Antibody to Apolipoprotein A1 (APOA1)
MBS2015526-03 0.5 mL

FITC-linked Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details
FITC-linked Antibody to Apolipoprotein A1 (APOA1)
MBS2015526-04 1 mL

FITC-linked Antibody to Apolipoprotein A1 (APOA1)

Sign In for Pricing
View Details