Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G Rabbit pAb (APR30109N)

Product Specifications

Background

HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin) . The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-G Rabbit pAb (APR30109N) .

Synonyms

MHC-G; HLA-G

Gene ID

3135

UniProt

P17693

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3135

Uniprot URL

https://www.uniprot.org/uniprot/P17693

AA Sequence

TETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWAL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Zfand2a (NM_001159908) Mouse Tagged ORF Clone Lentiviral Particle
MR201436L4V 200 µL

Zfand2a (NM_001159908) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Monoclonal CD38 Antibody (AT13/5) [Janelia Fluor 549]
NBP2-81055JF549 0.1 mL

Rabbit Monoclonal CD38 Antibody (AT13/5) [Janelia Fluor 549]

Ask
View Details
PUMA (p53 Upregulated Modulator of Apoptosis, BCL2 Binding Component 3, BCL-2 Binding Component 3, BBC3, JFY1, JFY-1, p53 Up-regulated Modulator of Apoptosis, PUMA alpha, PUMA/JFY1)
MBS610635-01 0.1 mg

PUMA (p53 Upregulated Modulator of Apoptosis, BCL2 Binding Component 3, BCL-2 Binding Component 3, BBC3, JFY1, JFY-1, p53 Up-regulated Modulator of Apoptosis, PUMA alpha, PUMA/JFY1)

Ask
View Details
PUMA (p53 Upregulated Modulator of Apoptosis, BCL2 Binding Component 3, BCL-2 Binding Component 3, BBC3, JFY1, JFY-1, p53 Up-regulated Modulator of Apoptosis, PUMA alpha, PUMA/JFY1)
MBS610635-02 5x 0.1 mg

PUMA (p53 Upregulated Modulator of Apoptosis, BCL2 Binding Component 3, BCL-2 Binding Component 3, BBC3, JFY1, JFY-1, p53 Up-regulated Modulator of Apoptosis, PUMA alpha, PUMA/JFY1)

Ask
View Details
Chicken Eyes Absent Homolog 1 (EYA1) ELISA Kit
MBS9347646 Inquire

Chicken Eyes Absent Homolog 1 (EYA1) ELISA Kit

Ask
View Details
PAMCI (Ras Association Domain-Containing Protein 9, Peptidylglycine alpha-Amidating Monooxygenase COOH-Terminal Interactor, PAM COOH-Terminal Interactor Protein 1, P-CIP1, RASSF9, PCIP1) (MaxLight 550)
MBS6212966-01 0.1 mL

PAMCI (Ras Association Domain-Containing Protein 9, Peptidylglycine alpha-Amidating Monooxygenase COOH-Terminal Interactor, PAM COOH-Terminal Interactor Protein 1, P-CIP1, RASSF9, PCIP1) (MaxLight 550)

Ask
View Details