Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLLT3 Rabbit pAb (APR30092N)

Product Specifications

Background

Chromatin reader component of the super elongation complex (SEC, a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Specifically recognizes and binds acylated histone H3, with a preference for histone H3 that is crotonylated. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr, and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr. Also recognizes and binds histone H3 acetylated and butyrylated at 'Lys-9' (H3K9ac and H3K9bu, respectively, but with lower affinity than crotonylated histone H3. In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones. Recruitment of the SEC complex to crotonylated histones promotes recruitment of DOT1L on active chromatin to deposit histone H3 'Lys-79' methylation (H3K79me. Plays a key role in hematopoietic stem cell (HSC maintenance by preserving, rather than confering, HSC stemness. Acts by binding to the transcription start site of active genes in HSCs and sustaining level of H3K79me2, probably by recruiting DOT1L.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MLLT3 Rabbit pAb (APR30092N) .

Synonyms

MLLT3; AF9; YEATS3

Gene ID

4300

UniProt

P42568

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 63kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4300

Uniprot URL

https://www.uniprot.org/uniprot/P42568

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZTS2 (C-term) Rabbit Polyclonal Antibody
AP52575PU-N 400 µL

LZTS2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CtIP (RBBP8) Rabbit Polyclonal Antibody
TA380758 100 µL

CtIP (RBBP8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ApoER2 (LRP8) (C-term) Rabbit Polyclonal Antibody
AP13124PU-N 400 µL

ApoER2 (LRP8) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD180 Rabbit Polyclonal Antibody
ER2001-06 100 µL

CD180 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALAS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA810000AM 100 µL

ALAS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]

Sign In for Pricing
View Details
2-Hydroxy Nicotinic Acid
TRC-H948725-1G 1 g

2-Hydroxy Nicotinic Acid

Sign In for Pricing
View Details