Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Rabbit pAb (APR30074N)

Product Specifications

Background

This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AMPD3 Rabbit pAb (APR30074N) .

Synonyms

AMPD3

Gene ID

272

UniProt

Q01432

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/71kDa/76kDa/88kDa/89kDa Observed MW: 89kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=272

Uniprot URL

https://www.uniprot.org/uniprot/Q01432

AA Sequence

MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQRVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPPPLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map7d1 (NM_144941) Mouse Tagged ORF Clone
MR210935 10 µg

Map7d1 (NM_144941) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IgG1, Murine Negative Isotype Control (For rat tissue) (MaxLight 490) discontinued
I1904-78Y-ML490 100 µL

IgG1, Murine Negative Isotype Control (For rat tissue) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Calcitonin Gene Related Peptide (8-37), human
orb2693802-01 5 mg

Calcitonin Gene Related Peptide (8-37), human

Sign In for Pricing
View Details
Calcitonin Gene Related Peptide (8-37), human
orb2693802-02 10 mg

Calcitonin Gene Related Peptide (8-37), human

Sign In for Pricing
View Details
STX2, NT (STX2, EPIM, STX2A, STX2B, STX2C, Syntaxin-2, Epimorphin) (MaxLight 405) discontinued
042437-ML405 100 µL

STX2, NT (STX2, EPIM, STX2A, STX2B, STX2C, Syntaxin-2, Epimorphin) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MXI1 Polyclonal Antibody
ABP59349-01 30 µL

MXI1 Polyclonal Antibody

Sign In for Pricing
View Details