Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEU1 Rabbit pAb (APR30071N)

Product Specifications

Background

The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein') . Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NEU1 Rabbit pAb (APR30071N) .

Synonyms

NEU1; NANH; NEU; SIAL1

Gene ID

4758

UniProt

Q99519

Cellular Locus

Cell membrane, Cytoplasmic vesicle, Lumenal side, Lysosome lumen, Lysosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4758

Uniprot URL

https://www.uniprot.org/uniprot/Q99519

AA Sequence

SLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN22 (NM_001193431) Human Tagged ORF Clone
RC231413 10 µg

PTPN22 (NM_001193431) Human Tagged ORF Clone

Sign In for Pricing
View Details
ALAD (aminolevulinate, delta-, dehydratase, ALADH, MGC5057, PBGS)
243237 50 µL

ALAD (aminolevulinate, delta-, dehydratase, ALADH, MGC5057, PBGS)

Sign In for Pricing
View Details
PAX8 (Paired Box 8) (MaxLight 550)
249766-ML550 100 µL

PAX8 (Paired Box 8) (MaxLight 550)

Sign In for Pricing
View Details
GLT1D1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0868705 3x 1.0 µg

GLT1D1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Perilipin 3 (PLIN3) (NM_001164194) Human Tagged Lenti ORF Clone
RC228339L3 10 µg

Perilipin 3 (PLIN3) (NM_001164194) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Horse Defensin Alpha 5, Paneth Cell Specific ELISA Kit
MBS037812-01 48 Well

Horse Defensin Alpha 5, Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details