Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGB7 Rabbit pAb (APR30066N)

Product Specifications

Background

This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer's patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Synonyms

ITGB7

Gene ID

3695

UniProt

P26010

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71kDa/86kDa Observed MW: 87kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ITGB7 Rabbit pAb (APR30066N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3695

Uniprot URL

https://www.uniprot.org/uniprot/P26010

AA Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UBE2L3, CT (UBE2L3, UBCE7, UBCH7, Ubiquitin-conjugating enzyme E2 L3, L-UBC, UbcH7, Ubiquitin carrier protein L3, Ubiquitin-conjugating enzyme E2-F1, Ubiquitin-protein ligase L3)
MBS6008637-01 0.2 mL

UBE2L3, CT (UBE2L3, UBCE7, UBCH7, Ubiquitin-conjugating enzyme E2 L3, L-UBC, UbcH7, Ubiquitin carrier protein L3, Ubiquitin-conjugating enzyme E2-F1, Ubiquitin-protein ligase L3)

Ask
View Details
UBE2L3, CT (UBE2L3, UBCE7, UBCH7, Ubiquitin-conjugating enzyme E2 L3, L-UBC, UbcH7, Ubiquitin carrier protein L3, Ubiquitin-conjugating enzyme E2-F1, Ubiquitin-protein ligase L3)
MBS6008637-02 5x 0.2 mL

UBE2L3, CT (UBE2L3, UBCE7, UBCH7, Ubiquitin-conjugating enzyme E2 L3, L-UBC, UbcH7, Ubiquitin carrier protein L3, Ubiquitin-conjugating enzyme E2-F1, Ubiquitin-protein ligase L3)

Ask
View Details
Human CA12 (Carbonic Anhydrase XII) ELISA Kit
MBS2500020-01 24 Tests

Human CA12 (Carbonic Anhydrase XII) ELISA Kit

Ask
View Details
Human CA12 (Carbonic Anhydrase XII) ELISA Kit
MBS2500020-02 48 Tests

Human CA12 (Carbonic Anhydrase XII) ELISA Kit

Ask
View Details
Human CA12 (Carbonic Anhydrase XII) ELISA Kit
MBS2500020-03 96 Tests

Human CA12 (Carbonic Anhydrase XII) ELISA Kit

Ask
View Details
Human CA12 (Carbonic Anhydrase XII) ELISA Kit
MBS2500020-04 5x 96 Tests

Human CA12 (Carbonic Anhydrase XII) ELISA Kit

Ask
View Details