Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN5 Rabbit pAb (APR30065N)

Product Specifications

Background

This gene encodes a member of an evolutionarily conserved family of proteins that may function as methyltransferases. This gene is located in a larger region of chromosome 7 that is deleted in Williams-Beuren syndrome, a multisystem developmental disorder. There are two pseudogenes for this gene located in the same region of chromosome 7. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NSUN5 Rabbit pAb (APR30065N) .

Synonyms

NSUN5; NOL1; NOL1R; NSUN5A; WBSCR20; WBSCR20A; p120; p120 (NOL1)

Gene ID

55695

UniProt

Q96P11

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/42kDa/46kDa/50kDa/51kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55695

Uniprot URL

https://www.uniprot.org/uniprot/Q96P11

AA Sequence

SCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCSF Receptor (CSF3R) Rabbit Polyclonal Antibody
TA392415 100 µL

GCSF Receptor (CSF3R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Icam5 Polyclonal Antibody
E-AB-66553-01 60 µL

Icam5 Polyclonal Antibody

Sign In for Pricing
View Details
Icam5 Polyclonal Antibody
E-AB-66553-02 120 µL

Icam5 Polyclonal Antibody

Sign In for Pricing
View Details
Icam5 Polyclonal Antibody
E-AB-66553-03 200 µL

Icam5 Polyclonal Antibody

Sign In for Pricing
View Details
Human Gastric Mucin (MUC6) activation kit by CRISPRa
GA103037 1 Kit

Human Gastric Mucin (MUC6) activation kit by CRISPRa

Sign In for Pricing
View Details
CEBPA Antibody
KC-31409-01 50 μL

CEBPA Antibody

Sign In for Pricing
View Details