Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] PRMT2 Rabbit pAb (APR30059N)

Product Specifications

Background

Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2 of the androgen receptor (AR-mediated transactivation. Acts as a coactivator (with estrogen of estrogen receptor (ER-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner. May be involved in growth regulation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] PRMT2 Rabbit pAb (APR30059N) .

Synonyms

PRMT2; HRMT1L1

Gene ID

3275

UniProt

P55345

Cellular Locus

Cytoplasm, Nucleus, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/31kDa/32kDa/33kDa/37kDa/49kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3275

Uniprot URL

https://www.uniprot.org/uniprot/P55345

AA Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat KLK6 Protein (His Tag)
PDER100152-01 20 µg

Recombinant Rat KLK6 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat KLK6 Protein (His Tag)
PDER100152-02 100 µg

Recombinant Rat KLK6 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat KLK6 Protein (His Tag)
PDER100152-03 500 µg

Recombinant Rat KLK6 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat KLK6 Protein (His Tag)
PDER100152-04 1 mg

Recombinant Rat KLK6 Protein (His Tag)

Sign In for Pricing
View Details
Human CXADR Recombinant Rabbit monoclonal Antibody
HA725294H 100 µL

Human CXADR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL
BNC743241-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details