Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10 Rabbit pAb (APR29965N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality S100A10 Rabbit pAb (APR29965N) .

Synonyms

S100A10; 42C; ANX2L; ANX2LG; CAL1L; CLP11; Ca[1]; GP11; P11; p10

Gene ID

6281

UniProt

P60903

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 11KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6281

Uniprot URL

https://www.uniprot.org/uniprot/P60903

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTN2 Protein Vector (Human) (pPM-C-HA)
PV050927 500 ng

CNTN2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant A. victoria Aequorea victoria GFP Protein, His, E.coli-1mg
QP7182-ec-1mg 1mg

Recombinant A. victoria Aequorea victoria GFP Protein, His, E.coli-1mg

Sign In for Pricing
View Details
3-Bromo-6-ethoxyquinolin-4-ol
OR81258 1 g

3-Bromo-6-ethoxyquinolin-4-ol

Sign In for Pricing
View Details
Rabbit Polyclonal RNASE12 Antibody
NBP1-94162 0.1 mL

Rabbit Polyclonal RNASE12 Antibody

Sign In for Pricing
View Details
Recombinant Anti-DPP4/CD26 Antibody (FITC), Rabbit Monoclonal
MBS8111984-01 25 Tests

Recombinant Anti-DPP4/CD26 Antibody (FITC), Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-DPP4/CD26 Antibody (FITC), Rabbit Monoclonal
MBS8111984-02 100 Tests

Recombinant Anti-DPP4/CD26 Antibody (FITC), Rabbit Monoclonal

Sign In for Pricing
View Details