Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAP2 Rabbit pAb (APR29949N)

Product Specifications

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.

Synonyms

TAP2; ABC18; ABCB3; APT2; D6S217E; PSF-2; PSF2; RING11

Gene ID

6891

UniProt

Q03519

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa/75kDa Observed MW: 75KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAP2 Rabbit pAb (APR29949N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6891

Uniprot URL

https://www.uniprot.org/uniprot/Q03519

AA Sequence

YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQAVQRAHQILVLQEGKL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FAK Antibody (phospho Ser732)
GWB-2C7E7E 0.05 mL

FAK Antibody (phospho Ser732)

Ask
View Details
KDM1B CRISPRa sgRNA lentivector (set of three targets)(Rat)
25469126 3 x 1.0μg DNA

KDM1B CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Anti-Hepatocyte Specific Antigen(HSA133), CF640R conjugate
BNC400133-500 500 µL

Anti-Hepatocyte Specific Antigen(HSA133), CF640R conjugate

Ask
View Details
Acidic hair keratin K32 antibody
20R-2617 100 uL

Acidic hair keratin K32 antibody

Ask
View Details
PDLIM5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C11]
TA504505AM 100 µL

PDLIM5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C11]

Ask
View Details