Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A16 Rabbit pAb (APR29819N)

Product Specifications

Background

This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC25A16 Rabbit pAb (APR23477N6) .

Synonyms

SLC25A16; D10S105E; GDA; GDC; HGT.1; ML7; hML7

Gene ID

8034

UniProt

P16260

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8034

Uniprot URL

https://www.uniprot.org/uniprot/P16260

AA Sequence

APYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati
MBS6392115-01 0.1 mL

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati

Ask
View Details
RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati
MBS6392115-02 5x 0.1 mL

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugati

Ask
View Details
P-Nitrophenyl 6-Sulfo-2-acetamido-2-deoxy-b-D-glucopyranoside, Potassium Salt discontinued
N2610 50 mg

P-Nitrophenyl 6-Sulfo-2-acetamido-2-deoxy-b-D-glucopyranoside, Potassium Salt discontinued

Ask
View Details
USP13, NT (Ubiquitin Carboxyl-terminal Hydrolase 13, Ubiquitin Thiolesterase 13, Ubiquitin-specific Processing Protease 13, Deubiquitinating Enzyme 13, Isopeptidase T-3, ISOT-3, ISOT3)
MBS623789-01 0.2 mL

USP13, NT (Ubiquitin Carboxyl-terminal Hydrolase 13, Ubiquitin Thiolesterase 13, Ubiquitin-specific Processing Protease 13, Deubiquitinating Enzyme 13, Isopeptidase T-3, ISOT-3, ISOT3)

Ask
View Details
USP13, NT (Ubiquitin Carboxyl-terminal Hydrolase 13, Ubiquitin Thiolesterase 13, Ubiquitin-specific Processing Protease 13, Deubiquitinating Enzyme 13, Isopeptidase T-3, ISOT-3, ISOT3)
MBS623789-02 5x 0.2 mL

USP13, NT (Ubiquitin Carboxyl-terminal Hydrolase 13, Ubiquitin Thiolesterase 13, Ubiquitin-specific Processing Protease 13, Deubiquitinating Enzyme 13, Isopeptidase T-3, ISOT-3, ISOT3)

Ask
View Details
Human SEC61G knockout cell line
ABC-KH13505 1 Vial

Human SEC61G knockout cell line

Ask
View Details