Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNN Rabbit pAb (APR29818N)

Product Specifications

Background

Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Component of the PSAP complex which binds RNA in a sequence-independent manner and is proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma.

Synonyms

PNN; DRS; DRSP; SDK3; memA; pinin

Gene ID

5411

UniProt

Q9H307

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/81kDa Observed MW: 130kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PNN Rabbit pAb (APR23445N4) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5411

Uniprot URL

https://www.uniprot.org/uniprot/Q9H307

AA Sequence

MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Srpx2 (NM_001108243) Rat Tagged ORF Clone Lentiviral Particle
RR209200L4V 200 µL

Srpx2 (NM_001108243) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Genorise® Biotinylated Canine TLR2 Polyclonal Antibody
GR109136 50 mg

Genorise® Biotinylated Canine TLR2 Polyclonal Antibody

Ask
View Details
Rps3a (BC084675) Mouse Tagged ORF Clone Lentiviral Particle
MR203493L4V 200 µL

Rps3a (BC084675) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
EZ-10 Spin Column Plasmid DNA Miniprep Kit
BS414 100preps

EZ-10 Spin Column Plasmid DNA Miniprep Kit

Ask
View Details