Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCYT1A Rabbit pAb (APR29788N)

Product Specifications

Background

This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PCYT1A Rabbit pAb (APR23441N3) .

Synonyms

PCYT1A; CCTA; CT; CTA; CTPCT; PCYT1; SMDCRD

Gene ID

5130

UniProt

P49585

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5130

Uniprot URL

https://www.uniprot.org/uniprot/P49585

AA Sequence

MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (DHLAG, HLA DR Gamma, HLADG, p35, Protein 41, CD74, CD74 Antigen (Invariant Polypeptide Of Major Histocompatibility Complex, Class II Antigen-Associated), CD74 Antigen, CD74 Molecule, CD74 Molecule, Major Histocompatibility Complex, Class II Invariant Chain, CLIP, DHLAG, Gamma Chain Of Class II Antigens, HG2A HUMAN, HLA Class II Histocompatibility Antigen Gamma Chain, HLA DR Antigens Associated Invariant Chain, HLA DR Gamma, HLA-DR Antigens-Associated Invariant Chain, HLA-DR-Gamma, HLADG, HLADR Antigens Associated Invariant Chain Ia Antigen Associated Invariant Chain, Ia Antigen-Associated Invariant Chain, Ia Associated Invariant Chain, Ia Gamma, Ii, Invariant Polypeptide Of Major Histocompatibility Complex Class II Antigen Associated, la-Gamma, Major Histocompatibility Complex Class II Invariant Chain, MHC HLA DR Gamma Chain, MHC HLA-DR Gamma Chain, p33, Protein 41)
384894 100 µg

CD74 (DHLAG, HLA DR Gamma, HLADG, p35, Protein 41, CD74, CD74 Antigen (Invariant Polypeptide Of Major Histocompatibility Complex, Class II Antigen-Associated), CD74 Antigen, CD74 Molecule, CD74 Molecule, Major Histocompatibility Complex, Class II Invariant Chain, CLIP, DHLAG, Gamma Chain Of Class II Antigens, HG2A HUMAN, HLA Class II Histocompatibility Antigen Gamma Chain, HLA DR Antigens Associated Invariant Chain, HLA DR Gamma, HLA-DR Antigens-Associated Invariant Chain, HLA-DR-Gamma, HLADG, HLADR Antigens Associated Invariant Chain Ia Antigen Associated Invariant Chain, Ia Antigen-Associated Invariant Chain, Ia Associated Invariant Chain, Ia Gamma, Ii, Invariant Polypeptide Of Major Histocompatibility Complex Class II Antigen Associated, la-Gamma, Major Histocompatibility Complex Class II Invariant Chain, MHC HLA DR Gamma Chain, MHC HLA-DR Gamma Chain, p33, Protein 41)

Sign In for Pricing
View Details
ELN (Elastin)
053394 200 µL

ELN (Elastin)

Sign In for Pricing
View Details
Rabbit Polyclonal FSTL5 Antibody
NBP1-52853 100 µL

Rabbit Polyclonal FSTL5 Antibody

Sign In for Pricing
View Details
TMEM120A (Transmembrane Protein 120A, TMPIT)
252792 50 µg

TMEM120A (Transmembrane Protein 120A, TMPIT)

Sign In for Pricing
View Details
AIM (CD5L) CytoSection
TS406528P5 25 Slides

AIM (CD5L) CytoSection

Sign In for Pricing
View Details
Porcine EFNA3 (Ephrin A3) ELISA Kit
MBS2514925-01 24 Tests

Porcine EFNA3 (Ephrin A3) ELISA Kit

Sign In for Pricing
View Details