Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD8 Rabbit pAb (APR29778N)

Product Specifications

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HOXD8 Rabbit pAb (APR23404N7) .

Synonyms

HOXD8; HOX4; HOX4E; HOX5.4

Gene ID

3234

UniProt

P13378

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 32kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3234

Uniprot URL

https://www.uniprot.org/uniprot/P13378

AA Sequence

RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAP-1 (h) -PR
sc-62485-PR 10 µM - 20 µL

ICAP-1 (h) -PR

Sign In for Pricing
View Details
NEIL3, ID (NEIL3, Endonuclease 8-like 3, DNA glycosylase FPG2, DNA glycosylase/AP lyase Neil3, Endonuclease VIII-like 3, Nei-like protein 3) (MaxLight 750)
MBS6324571-01 0.1 mL

NEIL3, ID (NEIL3, Endonuclease 8-like 3, DNA glycosylase FPG2, DNA glycosylase/AP lyase Neil3, Endonuclease VIII-like 3, Nei-like protein 3) (MaxLight 750)

Sign In for Pricing
View Details
NEIL3, ID (NEIL3, Endonuclease 8-like 3, DNA glycosylase FPG2, DNA glycosylase/AP lyase Neil3, Endonuclease VIII-like 3, Nei-like protein 3) (MaxLight 750)
MBS6324571-02 5x 0.1 mL

NEIL3, ID (NEIL3, Endonuclease 8-like 3, DNA glycosylase FPG2, DNA glycosylase/AP lyase Neil3, Endonuclease VIII-like 3, Nei-like protein 3) (MaxLight 750)

Sign In for Pricing
View Details
Avatrombopag hydrochloride
E4969-100mg 100 mg

Avatrombopag hydrochloride

Sign In for Pricing
View Details
ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) (AP) discontinued
128631-AP 100 µL

ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) (AP) discontinued

Sign In for Pricing
View Details
Rps28 (NM_016844) Mouse Tagged ORF Clone Lentiviral Particle
MR216902L3V 200 µL

Rps28 (NM_016844) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details