Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA3 Rabbit pAb (APR29770N)

Product Specifications

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KPNA3 Rabbit pAb (APR23420N7) .

Synonyms

KPNA3; IPOA4; SRP1; SRP1gamma; SRP4; hSRP1

Gene ID

3839

UniProt

O00505

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3839

Uniprot URL

https://www.uniprot.org/uniprot/O00505

AA Sequence

MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r12 Protein Vector (Mouse) (pPB-C-His)
PV245214 500 ng

Vmn1r12 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CDK1/CDC2 Antibody
MBS9611062-01 0.05 mL

CDK1/CDC2 Antibody

Sign In for Pricing
View Details
CDK1/CDC2 Antibody
MBS9611062-02 0.1 mL

CDK1/CDC2 Antibody

Sign In for Pricing
View Details
CDK1/CDC2 Antibody
MBS9611062-03 0.2 mL

CDK1/CDC2 Antibody

Sign In for Pricing
View Details
CDK1/CDC2 Antibody
MBS9611062-04 5x 0.2 mL

CDK1/CDC2 Antibody

Sign In for Pricing
View Details
NUDT10 sgRNA CRISPR Lentivector (Human) (Target 3)
K1465104 1.0 µg DNA

NUDT10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details