Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA3 Rabbit pAb (APR29770N)

Product Specifications

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KPNA3 Rabbit pAb (APR23420N7) .

Synonyms

KPNA3; IPOA4; SRP1; SRP1gamma; SRP4; hSRP1

Gene ID

3839

UniProt

O00505

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3839

Uniprot URL

https://www.uniprot.org/uniprot/O00505

AA Sequence

MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Potassium channel subfamily K member 3 (KCNK3) ELISA Kit
abx529681 96 Tests

Mouse Potassium channel subfamily K member 3 (KCNK3) ELISA Kit

Sign In for Pricing
View Details
MYADM (NM_001020818) Human Over-expression Lysate
LS091663-100ug 100 µg

MYADM (NM_001020818) Human Over-expression Lysate

Sign In for Pricing
View Details
Human UBE2F knockout cell line
ABC-KH16419 1 Vial

Human UBE2F knockout cell line

Sign In for Pricing
View Details
ZNF200 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV717102 1.0 µg DNA

ZNF200 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Adenosine 3’,5’-cyclic Monophosphate, 8-Bromo-, Sodium Salt (8-Bromo-cAMP, Na)
217142 10 mg

Adenosine 3’,5’-cyclic Monophosphate, 8-Bromo-, Sodium Salt (8-Bromo-cAMP, Na)

Sign In for Pricing
View Details
LGR6 Antibody
A70271-100UG 100 µg

LGR6 Antibody

Sign In for Pricing
View Details