Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AURKC Rabbit pAb (APR29761N)

Product Specifications

Background

This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AURKC Rabbit pAb (APR23451N7) .

Synonyms

AURKC; AIE2; AIK3; ARK3; AurC; HEL-S-90; SPGF5; STK13; aurora-C

Gene ID

6795

UniProt

Q9UQB9

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/33kDa/35kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6795

Uniprot URL

https://www.uniprot.org/uniprot/Q9UQB9

AA Sequence

MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP7 siRNA (Human)
CRJ2907-01 15 nmol

THAP7 siRNA (Human)

Sign In for Pricing
View Details
THAP7 siRNA (Human)
CRJ2907-02 30 nmol

THAP7 siRNA (Human)

Sign In for Pricing
View Details
CCDC41 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15263124 3x 1.0µg DNA

CCDC41 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Mast cell protease 9 (MCPT9) ELISA Kit
abx532511 96 Tests

Mouse Mast cell protease 9 (MCPT9) ELISA Kit

Sign In for Pricing
View Details
Human interleukin 2 (IL-2) antibody ELISA Kit
CSB-E14211h-01 24 Well

Human interleukin 2 (IL-2) antibody ELISA Kit

Sign In for Pricing
View Details
Human interleukin 2 (IL-2) antibody ELISA Kit
CSB-E14211h-02 96 Well

Human interleukin 2 (IL-2) antibody ELISA Kit

Sign In for Pricing
View Details